cExams.net
869. Fact
The pig is the only animal that, like humans, can get a suntan.

870. Fact
The world's longest city name has 167 characters. Krungthepmahanakornamornrattanakosinmahintarayutthayamahadilokphopnoparatrjathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkatattiyavisanukamprasit. It translates into: the great city of angels, the supreme unconquerable land of the great immortal divinity, the royal capital of nine noble gems, the pleasant city, with plenty of grand royal palaces, and divine paradises for the reincarnated deity, given by indra and created by the god of crafting. It is known to the rest of the world as bangkok, thailand.

871. Fact
Bruce willis is left-handed. To get a better camera angle, in the film sixth sense, he wrote with his right hand in one scene.

872. Fact
Grampus, a playful, black and white dolphin, can live to the ripe old age of 80 to 90 years.

873. Fact
It takes 240 million years for our solar system to travel around the center of our galaxy, the milky way. This is known as a cosmic year.

874. Fact
Some of the larger battle scenes in the film braveheart had to be done twice, because many people with walk-on parts could be seen wearing watches and sunglasses.

875. Fact
Antoine saint-exupry, the french author who wrote the little prince, died when his small plane crashed on july 31, 1944. Why the plane crashed is still unknown.

876. Fact
A mule is the spawn of a donkey and a mare.

877. Fact
Coulfophobia is the technical term for a fear of clowns.

878. Fact
Star trek, the famous tv series, was not a hit when if first started. After only two seasons, the tv network wanted to cancel it.

879. Fact
Wrigley's, the american chewing gum, was the first product in the world with a bar code.

880. Fact
If you suffer from polydactyl, you were born with more than 10 fingers and toes.

881. Fact
The nobel prizewinner marie curie was the first woman allowed to teach at the university of sorbonne in paris.

882. Fact
A lightning bolt will heat up the air around it to about 3,000272c (5432 degrees fahrenheit).

883. Fact
In an earlier version of the script for the film alien, ripley was supposed to be played by a man.

884. Fact
During the first world war, josef stalin got out of serving his military service because of his deformed feet. He had two toes that were grown together.

885. Fact
A dragonfly can fly backwards as fast as it can fly forwards.

886. Fact
The pitohuis, a group of birds in new guinea, have poisonous feathers and skin. When predators catch one of these birds, they instinctively spit it out.

887. Fact
If you love coffee and drink 100 cups in four hours,you will probably die from caffeine poisoning.

888. Fact
Before michael caine and cher changed their names, they answered to maurice micklewhite and cherilyn sarkisian la piere.

889. Fact
Only two of your mouth muscles are required for creating a smile unless you consider the many muscles around your eyes as well.

890. Fact
Men and women button their shirts differently. A practice that comes from olden times when royal men dressed themselves but the women used chambermaids who buttoned their blouses for them from the front.

891. Fact
The language with the greatest number of words is english. It contains more than 455,000 active words and 700,000 dead words.

892. Fact
Raw asparagus is slightly poisonous.

893. Fact
Arnold schwarzenegger received a cool 15 million dollars for his part in terminator 2, where he only spoke 700 words. That's $21,429 per word. The classic phrase "hasta la vista, baby" earned him $85,716.

894. Fact
Ghandi's full name wasn't mahatma gandhi. His real name was mohandas karamchand gandhi. Mahatma was a title of honour which means large spirit.

895. Fact
The tools that were used to fix up jack napier (jack nicholson) after his chemical bath in batman are the same tools used by the sadistic dentist, orin scrivello (steve martin), in the 1986 film little shop of horrors.

896. Fact
On a flight from antwerp to london in 1997, 21 of the passengers were 100 years old.

897. Fact
Most fish stay awake most of their lives. However, there are fish that sleep. They lean against a rock or stand vertically in the water.

898. Fact
A snail can sleep for three years.

899. Fact
Mosquitoes can track people up to 110 yards away by the substances in their breath.

900. Fact
The largest painting in the world is the battle at gettysburg, created by the american paul phillipoteaux and 16 of his assistants. It stands 68.8-feet high and is 410-feet wide.

901. Fact
The tyrannosaurus rex suffered from gout.

902. Fact
There are 336 dimples in a golf ball.

903. Fact
The most widely used language in the world is mandarin-chinese, the mother tongue for almost 900 million people. Only 332 million people have english as their mother tongue.

904. Fact
To produce 1 single gram of serum, you need poison from 150 cobra bites.

905. Fact
Alfred nobel's brother emil, died in an explosion in the laboratory where both brothers were performing experiments with explosive oils, the forerunner to dynamite.

906. Fact
If all the rain in our atmosphere fell at the same time, it would cover the earth with a one-inch thick layer of water.

907. Fact
The centre of the sun is 15 million degrees celsius. The surface is only 5,800 degrees celcius (10472 degrees fahrenheit).

908. Fact
The salt in your tears comes from the food you eat. It's transported via the blood circulation to the lacrimal gland near your eyes where tears are produced.

909. Fact
If you suffer from dentophobia, you have an extreme fear of dentists.

910. Fact
Jonathan frakes refused to shave his back in the love scene with martina martis in the film star trek: nemesis. The hair had to be digitally removed.

911. Fact
The black and white lines found on a bar code, symbolize different numbers. Together they form a long code that contains all necessary data for a product.

912. Fact
The biggest difference between an "ebb" and a "flood" was measured in nova scotia, canada's bay of fundy. The difference was 52 feet.

913. Fact
Ichthyosaurs, sea dwelling dinosaurs, lived during the jurasic period and had eyes 9-inches wide.

914. Fact
Barbie's full name is barbara millicent roberts.

915. Fact
The song of a humpback whale can reach 190 db. That's equivalent to the sound of a boeing 747 at takeoff.

916. Fact
Before josef stalin became a revolutionist, he considered a career as a priest. He was thrown out of seminary, though, because of his drinking and aggressive behaviour.

917. Fact
Walt disney was afraid of mice.

918. Fact
Twenty percent of the world's population has a genetic disorder that causes the lack of wisdom teeth.

>

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31

  • Montreal
  • 101 Reasons to go Vegetarian
  • Class 9 - Area of Parallelogram and Triangles
  • What to Eat in Arunachal Pradesh
  • International Christmas Desserts
  • Benefits of Celery

  • SuperFood

    Quinces

    Quinces originated in the Caucasus region, and Turkey remains the largest producer, although they are grown throughout the Middle East as well as in Chile, Uruguay, and Argentina. Though quinces were once grown widely in the United States, they have been subject to insects and blights, and now most of the quinces available in the United States come from Argentina.
    Quinces are especially high in pectin, a soluble fiber that helps lower blood cholesterol. Quinces are a good source of vitamin A and iron, and they provide moderate amounts of potassium, vitamin C, and calcium. Quinces’ high acid content is thought to help with the digestion of fatty meals. Research on the closely related Chinese quince shows potential for preventing stomach lesions and combating some viruses.
    The high pectin content of quinces accounts for their common use in jams and jellies. Quinces were traditionally used to produce an extract for treating coughs and sore throat, as well as for digestive problems. They also have a pleasing sweet smell and have long been used as the base for pomanders.
    Nutritional Facts :
    One medium raw quince provides 52 calories, 14.1 g carbohydrate, 0.4 g protein, 0.1 g fat, 1.7 g dietary fiber, 37 IU vitamin A, 14 mg vitamin C, 3 mcg folic acid, 181 mg potassium, 4 mg sodium, 16 mg phosphorus, 10 mg calcium, 7 mg magnesium, and 0.12 mg iron.


    Chourishi Systems